DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and SNX19

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_024304289.1 Gene:SNX19 / 399979 HGNCID:21532 Length:1074 Species:Homo sapiens


Alignment Length:396 Identity:89/396 - (22%)
Similarity:154/396 - (38%) Gaps:107/396 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMDGTDDS-----NLLNSPSTNNGATMEIASPTNPLATPPATGGAPAP-SGATNGSGSATSPDSS 59
            :::|.:.:     :.|....||:.::::...|...|::.|     |.| |.||......:|||. 
Human   468 LLEGPEKTCPSRPSCLEKDLTNDVSSLDPTLPPVLLSSSP-----PGPLSSATFSFEPLSSPDG- 526

  Fly    60 SSAPATPAVLGENALHVEISDALSEKEK--------VKFTVHTRTTLPGFSKKD------NNVVR 110
                  |.::    .::.|:..::.:|.        ..:||...|.|.|.:...      :.|.|
Human   527 ------PVII----QNLRITGTITAREHSGTGFHPYTLYTVKYETALDGENSSGLQQLAYHTVNR 581

  Fly   111 QHEEFVWLHDRIEENDDYAGYIIPPCPPR---PDFDASREKLQRLGEGEGNMTKEEFKKMKSELE 172
            ::.||:.|..|:||..|...:|.....|:   ||...            |||..:..:..||.||
Human   582 RYREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPL------------GNMDSDRVEARKSLLE 634

  Fly   173 AEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKS--LGK 235
            :               ||::|.:.|.....:.::.||..:.|      .::|    |||.  :..
Human   635 S---------------FLKQLCAIPEIANSEEVQEFLALNTD------ARIA----FVKKPFMVS 674

  Fly   236 TTDEILLSATVRDVNDFF-ENELQFLTEYHGHLREAALRTEKMTQRHK----DVGDSHQKISNAL 295
            ..|::::||.|..:...| .:|.|..||   .|.||...::..|:..|    .:..|..|||.||
Human   675 RIDKMVVSAIVDTLKTAFPRSEPQSPTE---ELSEAETESKPQTEGKKASKSRLRFSSSKISPAL 736

  Fly   296 TQLSTTEK-------GNV----------ETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQ 343
            :.....:|       |||          |:|:.|..::.|    ::...|.::|.:.....|...
Human   737 SVTEAQDKILYCLQEGNVESETLSMSAMESFIEKQTKLLE----MQPTKAPEKDPEQPPKGRVDS 797

  Fly   344 RDSDAA 349
            ..||||
Human   798 CVSDAA 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 33/156 (21%)
BAR_SNX5_6 228..452 CDD:153305 38/146 (26%)
SNX19XP_024304289.1 PXA 95..272 CDD:214611
FtsK <270..>332 CDD:332908
PX_SNX19 532..659 CDD:132803 33/153 (22%)
Nexin_C 931..1027 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.