DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx4

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001121022.1 Gene:Snx4 / 360725 RGDID:1309763 Length:450 Species:Rattus norvegicus


Alignment Length:489 Identity:106/489 - (21%)
Similarity:180/489 - (36%) Gaps:154/489 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SPTNPLATPPATGGAPAPSGATNGSGSATSPDSSSSAPATPAVLGENALHVEISDALSEKEK--- 87
            :|..||..|.|...| |....|.|    |..|.|.:...|    |.|....:|..::||.||   
  Rat    15 APLEPLGGPGAVLEA-AVGEETEG----TREDVSGADTMT----GNNFWLKKIEISVSEAEKRTG 70

  Fly    88 ----------VKFTVHTRTT--LPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPR- 139
                      ..:.:.||:.  ..|.|...:::.|::.||..|.:.:...  |...::||.|.: 
  Rat    71 RNAMNMQETYTAYLIETRSVEHADGQSVLTDSLWRRYSEFELLRNYLLVY--YPHVVVPPLPEKR 133

  Fly   140 --------------PDFDASREKLQRLG------------------------EGEGNMTKEEFKK 166
                          |||...|    |:|                        ..|||. ||...:
  Rat   134 AEFVWHKLSADNMDPDFVERR----RIGLENFLLRVASHPVLCRDKIFYLFLTQEGNW-KETVNE 193

  Fly   167 MKSELEAE-----YLATFK------------------KTVAMHEVFLR-RLAS--HPVFRV-DQH 204
            ...:|:|:     ..|||:                  ::|..|.:.:| |:|.  :.|::| ..:
  Rat   194 TGFQLKADSRLKALNATFRVKNPDKRFTELRQYSDELQSVISHLLRIRARVADRLYGVYKVHGNY 258

  Fly   205 LKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFFENELQF---LTEY--H 264
            .:||.|:     :...|:|   |..::|.|...|....|     ::|..|:|..:   |.||  :
  Rat   259 GRVFSEW-----SAIEKEM---GDGLQSAGHHMDVYASS-----IDDILEDEEHYADQLKEYLFY 310

  Fly   265 GHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKGNVETFVAKTAEIFERIKNLETRVAS 329
            .....|..|..::.|  .|:..:.|.:::...|......|.|.||         .:|.:.|::..
  Rat   311 AEALRAVCRKHELMQ--YDLETAAQDLASKKQQCEELATGTVRTF---------SLKGMTTKLFG 364

  Fly   330 DQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKARSKNKDVHAPLEVQE-AETAQ 393
            .:..:        ||::         |::.|.  |..|...::.:|||      ||.:| .:.|.
  Rat   365 QETPE--------QREA---------RIKVLE--EQINEGEQQLKSKN------LEGREFVKNAW 404

  Fly   394 AEACEKF-ESMSACGKEELIGFRNRRVAAFKKSL 426
            |: .|:| |..:...||.||.:...:::..||.:
  Rat   405 AD-IERFKEQKNRDLKEALISYAVMQISMCKKGI 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 44/220 (20%)
BAR_SNX5_6 228..452 CDD:153305 45/206 (22%)
Snx4NP_001121022.1 PX_SNX4 58..184 CDD:132774 23/131 (18%)
BAR_SNX4 205..448 CDD:153306 61/283 (22%)
Med21 <324..398 CDD:288119 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.