DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and snx1a

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001122143.2 Gene:snx1a / 337386 ZFINID:ZDB-GENE-060302-3 Length:659 Species:Danio rerio


Alignment Length:492 Identity:112/492 - (22%)
Similarity:212/492 - (43%) Gaps:91/492 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TNPLATPPATGGAPAPSGATNGSGS--------AT----------------SPDSSSSAPATPAV 68
            |....||||:  .||.:..|||..|        ||                |.:.|.||||.|..
Zfish   195 TEEALTPPAS--KPAANTRTNGVHSEEQDLFSEATVELSLDSPHNDRKKKDSVNPSVSAPAAPVA 257

  Fly    69 LG---------------ENALHVEISDALSEKEKV--------KFTVHTRTTLPGFSKKDNNVVR 110
            ..               |:....:::.:::..|||        .:.|.|:|:|..|..|...|.|
Zfish   258 SSSSKPPSKTLEELEEEESEDKFDLNVSITNPEKVGDGMNAYMVYKVSTQTSLSMFRSKTFTVRR 322

  Fly   111 QHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEF-KKMKSELEAE 174
            :..:|:.|::::.|.....|||:||.|.:.....::.|:     |:.:.:..|| ::.::.||. 
Zfish   323 RFSDFLGLYEKLSEKHSQNGYIVPPPPEKSIMGMTKVKV-----GKEDPSSAEFVERRRAALER- 381

  Fly   175 YLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPR--KKMAIFG-GFVKSLGKT 236
                          :|:|:.|||....|..::.|||.::    .||  ....:.| ||:|.|.|.
Zfish   382 --------------YLQRVVSHPSLLQDPDVREFLEKEE----LPRAVSTQTLSGAGFLKMLNKA 428

  Fly   237 TDEI-LLSATVRDVNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLST 300
            ||.: .::..:.:.:.:|:.::|.:......||:..:..|.:....|::..:....:.::..|.:
Zfish   429 TDAVSKMTIKMNEQDVWFDEKIQDVENEEQLLRKLHVMVESLVNHRKELSGNTAAFAKSVAMLGS 493

  Fly   301 TEKGN-VETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYE 364
            :|... :...:::.||:.:||:.|....|::......:.|..|.|...|.:....:|::....::
Zfish   494 SEDNTALSRALSQLAEVEDRIEQLHRDQAANDFFTFAELLADYIRLLGAVRGCFDQRMKAWQRWQ 558

  Fly   365 AANRNLEKARSKNKDV---HAPLEVQEA--ETAQAEAC-----EKFESMSACGKEELIGFRNRRV 419
            .|...|:|.|.....:   :.|.::|:|  |.|:.||.     ..||.:||..::::|.|...:.
Zfish   559 DAESMLQKKREAEAKLLWANKPDKLQQAKDEIAEWEAKVTQYERDFERISATVQKDVIRFDKEKA 623

  Fly   420 AAFKKSLVELSELEIKHAKTQ-YEYLRQSLLALKEIA 455
            ..||:.:::..| .:.|::.| .:|....|...|.||
Zfish   624 RDFKRQIIKYLE-SLLHSQQQLIKYWEAFLPEAKAIA 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 35/148 (24%)
BAR_SNX5_6 228..452 CDD:153305 50/236 (21%)
snx1aNP_001122143.2 Sorting_nexin 180..256 CDD:281663 19/62 (31%)
PX_SNX1 282..405 CDD:132814 35/142 (25%)
BAR_SNX1 423..656 CDD:153349 48/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.