DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx21

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster


Alignment Length:381 Identity:78/381 - (20%)
Similarity:121/381 - (31%) Gaps:139/381 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTDDSNLLNSPSTNNGATMEIASPTNPLATPP-----ATGGAPAPSGATNGSGSATSPDSSSSAP 63
            |.|:   |:||:. ..|.::|..|.:..|...     ||.....|:  |:||             
  Fly    23 GPDE---LDSPAI-EAAALDIPPPESDKALQKGVWERATSAEYKPT--TDGS------------- 68

  Fly    64 ATPAVLGENALHVEISDALSEKEKVK-FTVHTRTTLPGFSKKDN---NVVRQHEEFVWLHDRIEE 124
               .||..:.|...|.....|..|:| |.|:..|.....:.:|.   .:.|::.:|         
  Fly    69 ---TVLRFDILLAHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDF--------- 121

  Fly   125 NDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFK------KMKSELEAEYLATFKKTV 183
            .:.|.|                  |:|....|  |..:.|.      ..||||..|..|.|    
  Fly   122 RELYLG------------------LKRQHPAE--MANKYFPAKVLMGNFKSELIGERSAAF---- 162

  Fly   184 AMHEVFLRRLASHPVFRVDQHLKVFLEYDQ-----DLCAKPRKKMAIFGGFVKSLGKTTDEILLS 243
               |.||..:||..:.|..::...||::|:     ....:.|.:|||              .:|.
  Fly   163 ---EAFLTYVASQAMLRDSEYFLRFLQHDELTRACQFLDERRNEMAI--------------PILE 210

  Fly   244 ATVRDVNDFFENE----LQFL-----------TEYHGHLREAALRTEKMT--------------- 278
            ...|.:|..:.|.    |..|           ..:|...|.|.|...:..               
  Fly   211 NCFRLLNKIYMNRSRPVLLILCRLVAACTSSPVPHHAAERWALLALSRFETLCDIDLLPLYIPLL 275

  Fly   279 --------QRHKDVGDSHQKISNALTQLSTTEKGNVETFVAKTAEIFERIKNLETR 326
                    ||    |...:.|::.||.:|   |..:.|  |.|..:.:.|..::.|
  Fly   276 HTCAHLWWQR----GQDQKPITDRLTDMS---KQGINT--ANTESLMQAIHKIDPR 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 33/149 (22%)
BAR_SNX5_6 228..452 CDD:153305 23/137 (17%)
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 34/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.