DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx33

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001120960.1 Gene:Snx33 / 315696 RGDID:1307898 Length:574 Species:Rattus norvegicus


Alignment Length:362 Identity:73/362 - (20%)
Similarity:128/362 - (35%) Gaps:79/362 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELE 172
            |.|:::.|.||::|:...     :.:...|..|:..|:           |...::..:|.|..| 
  Rat   263 VYRRYKHFDWLYNRLLHK-----FTVISVPHLPEKQAT-----------GRFEEDFIEKRKRRL- 310

  Fly   173 AEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTT 237
                          .:::..:.||||....:..:.||....|...|..|:.|           ..
  Rat   311 --------------ILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRA-----------EK 350

  Fly   238 DEILLSATVRDVNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTE 302
            ||:        |...|....|..|| |..|::...|.:......|.:.||..::|....:|....
  Rat   351 DEM--------VGASFLLTFQIPTE-HQDLQDVEDRVDAFKAFSKKMDDSVLQLSTVAAELVRKH 406

  Fly   303 KGNVETFVAKTAEIFERIKN---LETRVASDQ-DLKLGDTLRYYQRDSD----AAKALLIRRLRC 359
            .|.......|....|:.|.:   ::....|:. :..:..|.|.|:...:    ..|..|.:.|..
  Rat   407 VGGFRKEFQKLGSAFQAISHAFQMDPPFRSEALNNAISHTGRTYETVGEMFAGQPKHDLFQMLDT 471

  Fly   360 LAAYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEACEKFESMSACGKEELIGFRNR-RVAAFK 423
            |:.|:....|.       .|:   :.:|:...|:.:..::........:||..|.|.| ||..|.
  Rat   472 LSLYQGLLSNF-------PDI---IHLQKGAFAKVKESQRMSDEGRMAQEEADGIRRRCRVVGFA 526

  Fly   424 KSLVELS------ELEIKHAKTQYEYLRQSLLALKEI 454
            .. .|::      ||:.||  ....||||.:|..:.:
  Rat   527 LQ-AEMNHFHQRRELDFKH--MMQSYLRQQILFYQRV 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 19/103 (18%)
BAR_SNX5_6 228..452 CDD:153305 50/238 (21%)
Snx33NP_001120960.1 SH3_SNX33 4..58 CDD:212829
PX_domain 230..354 CDD:295365 25/140 (18%)
BAR_SNX33 365..571 CDD:153353 45/210 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.