DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx19

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_006242809.1 Gene:Snx19 / 315478 RGDID:1309857 Length:900 Species:Rattus norvegicus


Alignment Length:372 Identity:88/372 - (23%)
Similarity:143/372 - (38%) Gaps:115/372 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DDSNL-----------LNSPS-----TNNGA-TMEIASPTNPLATPPATGGAPAP-SGATNGSGS 52
            ||::|           |..||     ..:|| ::|.|.|...|::.|     |.| |.||....|
  Rat   369 DDASLTALLEEPEKPCLQRPSCLDKGLGSGACSLEPAVPPLSLSSSP-----PGPLSSATFSFES 428

  Fly    53 ATSPDSSSSAPATPAVLGENALHVEISDALSEKEK--------VKFTVHTRTTLPGFSKKD---- 105
            .:|||.       |.|:    .::.|:..::.:|.        ..:||...|.|.|.:...    
  Rat   429 LSSPDG-------PVVI----QNLRITGTITAREHSGTGFHPYTLYTVKYETALSGENSSGLQQL 482

  Fly   106 --NNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPR---PDFDASREKLQRLGEGEGNMTKEEFK 165
              :.|.|::.||:.|..|:||..|...:|.....|:   ||...            |||..:..:
  Rat   483 AYHTVNRRYREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPF------------GNMDSDRVE 535

  Fly   166 KMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFV 230
            ..||.||:               |||:|.:.|.....:.::.||..:.|      .::|    ||
  Rat   536 ARKSLLES---------------FLRQLCAIPEIANSEEVQEFLALNTD------ARIA----FV 575

  Fly   231 KS--LGKTTDEILLSATVRDVNDFF-ENELQFLTEYHGHLREAALRTEKMTQRHK----DVGDSH 288
            |.  :....|::::||.|..:...| .:|.|..||   .|.||...::..|:..|    .:..|.
  Rat   576 KKPFMVSRIDKMVVSAIVDTLKTAFPRSEPQSPTE---ELSEAENESKPQTEGKKASKSRLRFSS 637

  Fly   289 QKISNALTQLSTTEK-------GN----------VETFVAKTAEIFE 318
            .||:.||:.....:|       ||          :|:|:.|..::.:
  Rat   638 SKIAPALSIAEAQDKILYCLQEGNSESEVLSMSGMESFIEKQTKLLQ 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 34/156 (22%)
BAR_SNX5_6 228..452 CDD:153305 28/115 (24%)
Snx19XP_006242809.1 PXA 95..265 CDD:295366
PX_SNX19 440..567 CDD:132803 34/153 (22%)
Nexin_C 753..853 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.