DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx11

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001012012.2 Gene:Snx11 / 303493 RGDID:1307319 Length:270 Species:Rattus norvegicus


Alignment Length:258 Identity:51/258 - (19%)
Similarity:89/258 - (34%) Gaps:83/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ENALHVEISDALSEKE-----KVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAG 130
            |..:.|.:.|...:.|     .|.:.:...|....|:.|.:.|.|::.|||||..:::.|   ||
  Rat    14 EEVITVRVQDPRLQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRN---AG 75

  Fly   131 YI-IPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLA 194
            .: :|..|.:..|..|.:              |..:|.:..|:             |  ||.::.
  Rat    76 LVPVPELPGKSTFFGSSD--------------EFIEKRRQGLQ-------------H--FLEKVL 111

  Fly   195 SHPVFRVDQHLKVFLEY-----DQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFFE 254
            ...|...|..|.:||:.     :.:.|.:.|..|            |..:.:||..:.:.     
  Rat   112 QSVVLLSDSQLHLFLQSQLSVPEIEACVQGRGSM------------TVSDAILSYAMSNC----- 159

  Fly   255 NELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKI--------SNALTQLSTTEKGNVETF 309
                      |..:|     |:.:..|...||.....        .|:.:...:.||.:|||:
  Rat   160 ----------GWAQE-----ERQSTSHLAKGDQLNSCCFLPRSGRRNSPSPPLSEEKDHVETW 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 32/150 (21%)
BAR_SNX5_6 228..452 CDD:153305 15/90 (17%)
Snx11NP_001012012.2 PX_SNX10 18..129 CDD:132808 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.