DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and SNX10

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001305127.1 Gene:SNX10 / 29887 HGNCID:14974 Length:227 Species:Homo sapiens


Alignment Length:162 Identity:33/162 - (20%)
Similarity:62/162 - (38%) Gaps:44/162 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VEISDALSEKE-------KVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYII 133
            |.:.|...:||       ..:..:||.:..  |:.|.:.|.|::.|||||..|::.|     .::
Human    39 VWVRDPRIQKEDFWHSYIDYEICIHTNSMC--FTMKTSCVRRRYREFVWLRQRLQSN-----ALL 96

  Fly   134 PPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPV 198
            ...|..|                   :|..|..|.:....:     ::...: |.|||::..:.:
Human    97 VQLPELP-------------------SKNLFFNMNNRQHVD-----QRRQGL-EDFLRKVLQNAL 136

  Fly   199 FRVDQHLKVFLE-----YDQDLCAKPRKKMAI 225
            ...|..|.:||:     .|.:.|...:.|.::
Human   137 LLSDSSLHLFLQSHLNSEDIEACVSGQTKYSV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 30/147 (20%)
BAR_SNX5_6 228..452 CDD:153305
SNX10NP_001305127.1 PX_SNX10 38..135 CDD:132808 26/127 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.