DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and SNX8

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_037453.1 Gene:SNX8 / 29886 HGNCID:14972 Length:465 Species:Homo sapiens


Alignment Length:445 Identity:89/445 - (20%)
Similarity:152/445 - (34%) Gaps:123/445 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSTNNGATMEIAS------PTNPLATPPA------TGGAPAPSGATNGSG-----SATSPDSSSS 61
            |:...||..|..:      |.:.|.||.|      ....||||......|     |.|..:    
Human    10 PAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQE---- 70

  Fly    62 APATPAVLGENALHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEEND 126
                  :|..:.:.||:   :.|| |..|..|....:.. .:..::|.|::.:||...:.:....
Human    71 ------LLARDTVQVEL---IPEK-KGLFLKHVEYEVSS-QRFKSSVYRRYNDFVVFQEMLLHKF 124

  Fly   127 DYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLR 191
            .|.  ::|..||:....|.||.::        ..:...|:                      |:.
Human   125 PYR--MVPALPPKRMLGADREFIE--------ARRRALKR----------------------FVN 157

  Fly   192 RLASHPVFRVDQHLKVFLEYD-QDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFFEN 255
            .:|.||:|..|..||:||.:. .|:..|.::.....|          ||.|.........||...
Human   158 LVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVG----------DEFLNCKLATRAKDFLPA 212

  Fly   256 ELQ------------FLTEYHGHLREAALRTEKMTQRHKD-------VGDSHQKISNALTQLSTT 301
            ::|            ....:| .||:   |.|::..|..|       .|.....|.:..|.|.:.
Human   213 DIQAQFAISRELIRNIYNSFH-KLRD---RAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSW 273

  Fly   302 EKGNVETFVAKTAEIFERIKNLETRVA--SDQDLKLG---------------DTLRYYQRDSDA- 348
            ...|..|:    ..:.:.:|.|....|  :|:..:.|               |.|:.|:...:. 
Human   274 AALNSSTW----GSLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERH 334

  Fly   349 AKALLIRRLRCLAAYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEACEKFESM 403
            .|.:|.:..|.|..|....|.:..|.::|::   |..|::.|:...|.....::|
Human   335 EKGVLHKHQRALHKYSLMKRQMMSATAQNRE---PESVEQLESRIVEQENAIQTM 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 29/139 (21%)
BAR_SNX5_6 228..452 CDD:153305 40/213 (19%)
SNX8NP_037453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 6/25 (24%)
PX_SNX8_Mvp1p_like 75..178 CDD:132776 29/139 (21%)
BAR_SNX8 195..440 CDD:153281 40/203 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.