DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx8

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001099382.1 Gene:Snx8 / 288504 RGDID:1305791 Length:463 Species:Rattus norvegicus


Alignment Length:431 Identity:89/431 - (20%)
Similarity:143/431 - (33%) Gaps:106/431 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LNSPSTNNGATMEIASPTNPLATPPATGGAPAPSGATNGSGSATSPDSSSSAPATP--------A 67
            |.||:....|..|    .:..|.|||||  |..|..|....  ..|.........|        .
  Rat     9 LPSPAVAAAAEAE----ADEEADPPATG--PQTSQVTEWRN--LDPRRMQMPQGNPLLLSYTLQE 65

  Fly    68 VLGENALHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYI 132
            :|.::.:.||:   :.|| |..|..|....:.. .:..::|.|::.:||..|:.:.....|.  :
  Rat    66 LLAKDTVQVEL---IPEK-KGLFLKHVEYEVSS-QRFKSSVYRRYNDFVVFHEVLLHKFPYR--M 123

  Fly   133 IPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHP 197
            :|..||:....|.||.:    ||.....|.                          |:..:|.||
  Rat   124 VPALPPKRVLGADREFI----EGRRRALKR--------------------------FINLVARHP 158

  Fly   198 VFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVR-----DVNDFFENEL 257
            .|..|..||:||.:.........|:.|      :.:|.......|:|..:     |:...|....
  Rat   159 PFSEDVLLKLFLSFSGSDVQHKLKEAA------QCVGDEFTNCKLAARAKDFLPADIQTQFAMSR 217

  Fly   258 QFLTEYHGHLREAALRTEKMTQRHKD-------VGDSHQKISNAL------------TQLST--- 300
            :.:...:....:...|.|::..|..|       .|...::::.||            ..|||   
  Rat   218 ELIRNVYNSFYKLRDRAERIASRAIDNAADLLIFGKELRQVTLALGSDTTPLPSWAALHLSTWGS 282

  Fly   301 ---TEKGNVETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDA-AKALLIRRLRCLA 361
               ..||....|.....:..::.|..|..|....:|.| |.|:.|:...:. .|.:|.:..|.|.
  Rat   283 LKQALKGLSVEFALLADKAAQQGKKEENDVVEKLNLFL-DLLQSYKDLCERHEKGVLHKHQRALH 346

  Fly   362 AYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEACEKFES 402
            .|....|.:..|               |...:.|:.|:.||
  Rat   347 KYGLMKRQMMSA---------------AHGREPESVEQLES 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 32/139 (23%)
BAR_SNX5_6 228..452 CDD:153305 38/206 (18%)
Snx8NP_001099382.1 PX_SNX8_Mvp1p_like 70..173 CDD:132776 32/139 (23%)
BAR_SNX8 190..438 CDD:153281 37/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.