DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and vps17

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_593047.1 Gene:vps17 / 2543324 PomBaseID:SPAPJ696.01c Length:549 Species:Schizosaccharomyces pombe


Alignment Length:513 Identity:114/513 - (22%)
Similarity:199/513 - (38%) Gaps:135/513 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TDDSNLLNSPSTNNG-ATMEIASPTN-PLATPPATGGAPAPS------GATNGSGSATS------ 55
            |||  |:||...:.| :|::.....: |:.|......:..||      |:.||:.:.|.      
pombe     7 TDD--LMNSHVFSGGFSTLDDKGFQDVPIHTDMPGSISVEPSSEDANVGSVNGNINETPVFEADR 69

  Fly    56 --PDSSSSAPATPAVLGENA---------LHVEISDALSEKEK---VKFTVHTRTTLPGF-SKKD 105
              .:::.:..|..:..|||:         |.:.|.|..:|..|   :|..|  :||||.: ||..
pombe    70 LIAEATMNPSAASSTTGENSISQTGSGPFLRIRIVDIEAENSKDPVIKMNV--QTTLPAYRSKLY 132

  Fly   106 NNVVRQHEEFVWLHDRIEENDDYAGYII---PPC--PPRPDFDASREKLQRLGEGEGNMTKEEFK 165
            .||.|.|.||          ..:|.|:|   |.|  |..|:...|      :..|    .||:..
pombe   133 KNVRRTHAEF----------KKFAKYLISTHPECLIPAVPEAKTS------VSSG----IKEDLI 177

  Fly   166 KMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDL-----CAKPR---KK 222
            .:||.|::               :|..::::|....|..|::|:|.|...     ...|.   |:
pombe   178 YLKSGLQS---------------WLNYVSTNPNLLYDPELQLFVESDYGYSPLINTGNPTSGLKR 227

  Fly   223 MAIFGGFVKSLGKTTDEILLSATVRD-VNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGD 286
            .|:     |......|.....|.:|. |..|::|           .::|.::.||:..|.:.:..
pombe   228 KAL-----KQFPLPPDPCQALANLRPIVKSFYKN-----------AKDAEIKLEKLVNRKQSLAL 276

  Fly   287 SHQKISNALTQLSTTEKGN-VETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAK 350
            :|..:..:|...|..|:.| :...:.:..::.:.|.::....:|.|.:.|.|:|.|...::...|
pombe   277 THADLGQSLIDYSVEEQHNGLANALNRVGKMLQAISDVRIMQSSKQLVTLADSLCYASDNAFVVK 341

  Fly   351 ALLIRR---LRCLAA--------YEAANR-----NLEKARSKNKDVHAPLEVQEAETAQAEACEK 399
            .:|..|   :|.|.:        ..||||     .:.|||:  .|....|||       |...||
pombe   342 EILSNRHILMRDLISSKNQTNSYLSAANRLQDSPKISKART--DDALQALEV-------ARVHEK 397

  Fly   400 FESMSACGKEELIGFRNRRVAAFKKSLVELSELEIKHAKTQY----EYLRQSLLALKE 453
            ..|       :.:.|....:....|:..:.:.:.::.|..:|    .|..:.||::.|
pombe   398 LLS-------DKVDFVTLNLVKESKTYTKKTSVSLQKAIREYVEKEAYYERRLLSIME 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 40/157 (25%)
BAR_SNX5_6 228..452 CDD:153305 50/245 (20%)
vps17NP_593047.1 PX_Vps17p 73..209 CDD:132801 43/172 (25%)
BAR 224..453 CDD:299863 53/257 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.