DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx30

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_766056.1 Gene:Snx30 / 209131 MGIID:2443882 Length:437 Species:Mus musculus


Alignment Length:496 Identity:103/496 - (20%)
Similarity:193/496 - (38%) Gaps:134/496 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSTNNGATMEIASPTNPLATPPATGGAPAPSG---------------ATNGSGSATSPDSSSSAP 63
            |||...:..::..|....::..|.||...||.               ...|:.:.|:..:|||:.
Mouse    10 PSTGPQSLRDMPHPLAGSSSEEAVGGDSTPSPDLLMARSFGDKDLILPNGGTPAGTASPASSSSL 74

  Fly    64 ATPAVLGENA------LHVEISD----ALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWL 118
            .....|.::.      |.|.:.|    ..:.:..:.:.:.|::|...|...:.:|.|::::|.||
Mouse    75 LNRLQLDDDIDGEARDLFVTVDDPKKHVCTMETYITYRITTKSTRVEFDLPEYSVRRRYQDFDWL 139

  Fly   119 HDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEF--KKMKSELEAEYLATFKK 181
            .:::||:.  ..::|||.|                        |:|  |.:......|::.|.:|
Mouse   140 RNKLEESQ--PTHLIPPLP------------------------EKFVVKGVVDRFSEEFVETRRK 178

  Fly   182 TVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIF-----------GGFVKSLGK 235
            .:   :.||:|:..|||...::|..|||. .:||.|..::.:|:.           ||:     |
Mouse   179 AL---DKFLKRITDHPVLSFNEHFNVFLT-AKDLNAYKKQGIALLSRVGESVKHVTGGY-----K 234

  Fly   236 TTDEILLSATVRDVNDFF---------------ENELQFLTEYHGHLREAALRTEKMTQRHKDVG 285
            .....|..|.:.|..|.|               :.|:::|.|    |||........:....::.
Mouse   235 LRSRPLEFAAISDYLDTFALKLGTIDRIAQRIIKEEIEYLVE----LREYGPVYSTWSALEGELA 295

  Fly   286 DSHQKISNALTQLSTTEKGNVETFVAK-TAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAA 349
            :..:.:|..:        ||..|.:.: |.:|.|...               ..||.|...||:.
Mouse   296 EPLEGVSACI--------GNCSTALEELTDDITEEFL---------------PVLREYVLYSDSM 337

  Fly   350 KALLIRRLRCLAAYEAANRNLEK-ARSKNKDVHAPLEVQEAETAQAEACEKFESMSACGKEELIG 413
            |.:|.:|.:..|.|||   .||. |..|.:....|.:|::.:       ::.|..:|..|.::..
Mouse   338 KGVLKKRDQVQAEYEA---KLEAVALRKEERPKVPADVEKCQ-------DRMECFNADLKADMER 392

  Fly   414 FRNRRVAAFKKSLVELSELEIKHAKTQYEYLRQSLLALKEI 454
            :::.:...|::.||.|::..|       :|..:.|:|.:.|
Mouse   393 WQSNKRHDFRQLLVGLADKNI-------QYYEKCLMAWESI 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 33/151 (22%)
BAR_SNX5_6 228..452 CDD:153305 49/240 (20%)
Snx30NP_766056.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 9/34 (26%)
PX_SNX7_30_like 91..206 CDD:132770 33/144 (23%)
BAR_SNX30 190..429 CDD:153351 62/287 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.