DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and snx-3

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_492437.1 Gene:snx-3 / 189240 WormBaseID:WBGene00006503 Length:162 Species:Caenorhabditis elegans


Alignment Length:171 Identity:37/171 - (21%)
Similarity:80/171 - (46%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGATNGSGSATSPDSSSSAPATPAVLGENALHVEISDALSE-KEKVKFT---VHTRTTLPGFSKK 104
            |||:......:...:...|.|.||    |.|.:|:.:.::. ..|:::|   :..|:.||.|.:|
 Worm     3 SGASATQRIPSKRQTLDEAYAPPA----NFLEIEVINPITHGVGKMRYTDYEIRMRSNLPVFKQK 63

  Fly   105 DNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKS 169
            :::|.|::.:|.|:...:|.:   :..::|..|                 |:....:..|:....
 Worm    64 ESSVRRRYSDFEWVRAELERD---SKIVVPTLP-----------------GKSFKRQLPFRSDDG 108

  Fly   170 ELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLE 210
            ..|.|::...:|.:   |:|:.::|.||:.:.::.|.:||:
 Worm   109 IFEEEFIENRRKAL---ELFINKVAGHPLAQNERSLHIFLQ 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 30/143 (21%)
BAR_SNX5_6 228..452 CDD:153305
snx-3NP_492437.1 PX_SNX3_like 28..150 CDD:132804 29/142 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.