DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and Snx18

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_570614.2 Gene:Snx18 / 170625 MGIID:2137642 Length:615 Species:Mus musculus


Alignment Length:536 Identity:101/536 - (18%)
Similarity:188/536 - (35%) Gaps:165/536 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGTDDS----------------NLLNSPSTNNGAT--------MEIASPTNPLATPPATGGAPAP 43
            |..|||                :|..|.|...||.        .:::..:..::.|||...:.|.
Mouse   147 DEWDDSSTVADEPGALGSGAYPDLDGSSSAGGGAAGRYRLSTRSDLSLGSRGVSAPPAHQASGAK 211

  Fly    44 SGAT---NGSGSATSPDSSSSAPATPAVLGENALHVEISDAL----------------------- 82
            |.||   |.:..:|...|...|    .||||.:..|:..|.|                       
Mouse   212 SSATVSRNLNRFSTFVKSGGEA----FVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTID 272

  Fly    83 SEKEKVKF----------TVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCP 137
            ...::.||          .|.|.|.:|        |.|:::.|.||:.|:.|.     :.:...|
Mouse   273 DPTKQTKFKGMKSYISYKLVPTHTQVP--------VHRRYKHFDWLYARLAEK-----FPVISVP 324

  Fly   138 PRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFR-- 200
            ..|:                       |:.....|.::::..:|.:..   ::..:|||||..  
Mouse   325 HLPE-----------------------KQATGRFEEDFISKRRKGLIW---WMNHMASHPVLAQC 363

  Fly   201 -VDQHLKVFLEYDQDLCAKPRKKMA-----IFGGFVKSLGKTTDEILLSATVRDVNDFFENELQF 259
             |.||.........:...|..|:.|     :...|..:|...      .|...|:.: .|:::..
Mouse   364 DVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTP------PAAALDLQE-VESKIDG 421

  Fly   260 LTEYHGHLREAALR---TEKMTQRHKDVG--DSHQKISNALTQLSTTEKGNVETF-------VAK 312
            ...:...:.::||:   |.....|.:..|  ..:||:..:...||...:.:.:.|       :|.
Mouse   422 FKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLNQAIAF 486

  Fly   313 TAEIFERIKNL---ETRVASDQDL-KLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKA 373
            |.:.::.|..|   :.|    ||| .:.|.|..||........::..:...|...:.:.|::|:.
Mouse   487 TGDAYDAIGELFAEQPR----QDLDPVMDLLALYQGHLANFPDIIHVQKGALTKVKESRRHVEEG 547

  Fly   374 RSKNKDVHAPLEVQEAETAQAEACEKFESMSACGKEELIGFRNRRVAAFKKSLVELSELEIKHAK 438
            :         :|||:|:..|    ::..::|.....|:..|...||..||.        :::|  
Mouse   548 K---------MEVQKADGIQ----DRCNTISFATLAEIHHFHQIRVRDFKS--------QMQH-- 589

  Fly   439 TQYEYLRQSLLALKEI 454
                :|:|.::..:::
Mouse   590 ----FLQQQIIFFQKV 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 29/175 (17%)
BAR_SNX5_6 228..452 CDD:153305 45/239 (19%)
Snx18NP_570614.2 SH3_SNX18 4..58 CDD:212830
PX_SNX18 267..394 CDD:132819 29/165 (18%)
BAR_SNX18 406..612 CDD:153354 43/228 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.