DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and AgaP_AGAP012012

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_320519.4 Gene:AgaP_AGAP012012 / 1280658 VectorBaseID:AGAP012012 Length:370 Species:Anopheles gambiae


Alignment Length:362 Identity:69/362 - (19%)
Similarity:130/362 - (35%) Gaps:114/362 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GENALHVEISDA-----LSEKEKVKFTVHT--RTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDD 127
            |:::...|::::     :..::|..|..|:  ...|.|..|   .|.|::::||.||..:.|...
Mosquito     5 GDDSTERELNESPVSVLIVPEKKGLFLKHSEYEIKLKGIEK---TVRRRYKDFVTLHRYLAEKYP 66

  Fly   128 YAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRR 192
            |.  ::|..||:.....|..:.:|.|                      |.|:...|::|.|    
Mosquito    67 YR--LLPALPPKQLMLDSLLEERRRG----------------------LQTWLIIVSLHPV---- 103

  Fly   193 LASHPVFRV-------DQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILL---SATVR 247
            |.|.|:...       |...::.:.|:                      |..||::.   .||:.
Mosquito   104 LGSSPIVSTFLRDTTNDHQYRLRVTYE----------------------KQMDELVRLRPDATLP 146

  Fly   248 DVNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKGNVETFVAK 312
            :|      :|..|             .|..|:.|:     .|.....|.||.....|:......:
Mosquito   147 EV------DLDTL-------------AESRTRLHR-----VQCSMGRLKQLFDRRLGHNRRQTGE 187

  Fly   313 TAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKARSKN 377
            .|||...:::.:.|.|.::|...        .|..|::.|:.:::......:      ::|.::.
Mosquito   188 CAEIERILQSPDLRDAFNEDATF--------EDLSASERLIAKQVERYVQVQ------QRAVTER 238

  Fly   378 KDVHAPLEVQEAETAQAEACEKFE-SMSACGKEELIG 413
            .||     :.|...|.::.||:.| |:.|..:..|.|
Mosquito   239 LDV-----LLEVLHAHSQLCERIEKSIVADQQRTLTG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 30/153 (20%)
BAR_SNX5_6 228..452 CDD:153305 37/190 (19%)
AgaP_AGAP012012XP_320519.4 PX_SNX8_Mvp1p_like 16..117 CDD:132776 28/131 (21%)
BAR_SNX8 130..365 CDD:153281 37/206 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.