DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and AgaP_AGAP009255

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_320042.3 Gene:AgaP_AGAP009255 / 1280217 VectorBaseID:AGAP009255 Length:448 Species:Anopheles gambiae


Alignment Length:450 Identity:105/450 - (23%)
Similarity:193/450 - (42%) Gaps:77/450 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TSPD---------SSSSAPATPAV-------LGENALHVEISDALSEKEKV--------KFTVHT 94
            ||||         |:...|.:|.:       .|:..:.:.::|    .:||        .:.|.|
Mosquito    28 TSPDDENENDIFESAIQEPLSPVLEDVPTDEAGDTFIEIVVAD----PQKVGDGMGSYLAYKVST 88

  Fly    95 RTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKL--QRLGEGEG 157
            :|.:..|.|:....:|:..:|:.|||.:.......|.||||.|.:.....::.::  |...|...
Mosquito    89 KTNILKFKKRQFFTMRRFSDFLGLHDLLVSKYLRMGRIIPPAPEKNIIGTTKVRMGSQPQAEAGA 153

  Fly   158 NMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPR-- 220
            .:..|..:..::.||.               ||.|:|.|||...|.....|||.||:|   ||  
Mosquito   154 GVNLEWIENRRASLER---------------FLNRVAQHPVLCQDTDFVNFLESDQEL---PRAV 200

  Fly   221 KKMAIFGGFVKSL----GKTTDEILLSATVRDVND-FFENELQFLTEYHGHLREAALRTEKMTQR 280
            ...|:.|..|..|    |:|.::|...   .|.|| :|.:::..:.....|:::.....:.:...
Mosquito   201 NTAALSGAGVMRLFNKVGETVNKITYK---MDENDPWFNDKISEVETIDAHMQKLHSAIKALVSH 262

  Fly   281 HKDVGDSHQKISNALTQLSTTEK-GNVETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQR 344
            .|::......::.:...|||.|: ..:...:::.|::.|:::.|.:..|:.....|.:|::.|..
Mosquito   263 RKELATLTGGVAKSAALLSTCEEHTGLSQALSQLADVEEKVELLRSEQANSDLYILSETIKDYIG 327

  Fly   345 DSDAAKALLIRRLRCLAAYEAANRNLEKARSKNKDVHAPLEVQE----AETAQAEA--------- 396
            ...|.|.:...|::....::.|...|.|.| :||   |.||:|:    .|.||.|.         
Mosquito   328 LFGAIKDVFHERVKVFQNWQHAQMQLTKKR-ENK---AKLELQDRRDKLEFAQKEVEEWEGKVQR 388

  Fly   397 CEK-FESMSACGKEELIGFRNRRVAAFKKSLVELSELEIKHAKTQYEYLRQSLLALKEIA 455
            |:| |:::|:..|:|:..|...|...||.::::..|.::.|.:.|..|....:...::||
Mosquito   389 CQKEFDNISSEIKKEMERFELARARDFKSTIIKYLEDQMAHQQQQMRYWEAIVPVARDIA 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 35/149 (23%)
BAR_SNX5_6 228..452 CDD:153305 53/243 (22%)
AgaP_AGAP009255XP_320042.3 PX_SNX1_2_like 64..193 CDD:132769 35/147 (24%)
BAR_SNX1_2 222..445 CDD:153307 49/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.