DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and snx8

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_031748693.1 Gene:snx8 / 100495787 XenbaseID:XB-GENE-12565250 Length:412 Species:Xenopus tropicalis


Alignment Length:371 Identity:75/371 - (20%)
Similarity:133/371 - (35%) Gaps:103/371 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLGENALHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYI 132
            :||.:.:.||:   :.|| |..|..|....:.. .:..:.|.|::.:||...:.:.:...|.  .
 Frog    18 ILGRDTVQVEL---IPEK-KGLFLKHVEYEVSS-QRFKSAVYRRYNDFVVFQEMLLQKYPYR--T 75

  Fly   133 IPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHP 197
            :|..||:....|.||                      .:||...|..:        |:..:|.||
 Frog    76 VPSLPPKRVLGADRE----------------------FIEARRRALTR--------FINLVARHP 110

  Fly   198 VFRVDQHLKVFLEYD-QDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFFENELQ--- 258
            .|..|..:.:||.|. ||:..|.|:.       |:.:|   ||.|:........||...::|   
 Frog   111 SFWDDLLVNIFLSYSGQDVQNKMRES-------VRGVG---DEYLICKFSAQAKDFLPADIQIQF 165

  Fly   259 ----------FLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKGNVETFVAKT 313
                      |.:.|  .||:   |.|:|..|..|...........|:.|. ::...:.::.|.|
 Frog   166 AASRELIRNLFNSFY--KLRD---RAERMAARAIDNATDLLSFGKELSALG-SDATPLPSWAAVT 224

  Fly   314 AEIFERIK------NLETRVASDQDLKLG---------------DTLRYYQRDSDA-AKALLIRR 356
            ...:..:|      ::|..:.:|:....|               |.|:.|:...:. .|.:|.:.
 Frog   225 QSTWSTLKQALKGLSVEFALLADKAAHQGKLEEIDVVEKLNLFLDLLQSYKDLCERHEKGVLHKH 289

  Fly   357 LRCLAAYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEACEKFES 402
            .:.|..|....:.:..|..::|              :||:.|:.||
 Frog   290 QKALHKYSLMKKQMMSATVQSK--------------EAESVEQLES 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 29/139 (21%)
BAR_SNX5_6 228..452 CDD:153305 39/210 (19%)
snx8XP_031748693.1 PX_SNX8_Mvp1p_like 22..125 CDD:132776 29/139 (21%)
BAR_SNX8 142..387 CDD:153281 37/200 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.