DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and sgk3

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_012820716.1 Gene:sgk3 / 100491891 XenbaseID:XB-GENE-492582 Length:490 Species:Xenopus tropicalis


Alignment Length:308 Identity:58/308 - (18%)
Similarity:98/308 - (31%) Gaps:133/308 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PRPDFDASREKLQRLGEGEGNMTKE----------------EFKKM------------KSELEAE 174
            |:...|.|.::.:|:.:..|:.:::                |:.|:            :.:.:..
 Frog   116 PKHQSDPSEDEDERVDQKNGSASRDVNLGPSGNPHAKPSDFEYLKLIGKGSFGKVVLTRGKRDGR 180

  Fly   175 YLA--TFKKTVAMHE-----------VFLRRLASHPVFRVDQHL------KVFLEYD-------- 212
            |.|  ..:|.|.:::           |.|:.: .|| |.|..|.      |:|...|        
 Frog   181 YYAVKVLQKNVILNKKEQRHIMAERNVLLKNV-KHP-FLVTLHYSFQTSDKLFFVLDFINGGELF 243

  Fly   213 -----QDLCAKPRKKMAIFGGFVKSLGKTTDEI-LLSATVRDVNDFFENELQFLTEYHGHLREAA 271
                 :...|:||   |:|  :...:|.....: .:....||:..  ||   .|.:..||:    
 Frog   244 FHLQRERYFAEPR---ALF--YAAEIGSALGYLHSIDIIYRDLKP--EN---ILLDSQGHI---- 294

  Fly   272 LRTEKMTQRHKDVGDSHQKISNA---LTQLSTTEKGNVETFVAK--------------------- 312
                .:|    |.|...:.|||:   ||...|.|....|..|.:                     
 Frog   295 ----VLT----DFGLCKEGISNSDTTLTFCGTPEYLAPEVIVKQPYDNTVDWWCLGSVLYEMLHG 351

  Fly   313 --------TAEIFERI--KNLETR--------------VASDQDLKLG 336
                    ||.::|.|  |.|.||              :..|..|:||
 Frog   352 LPPFYNRDTATMYENILHKPLTTRPDISLPAISILEELLEKDPKLRLG 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 20/120 (17%)
BAR_SNX5_6 228..452 CDD:153305 32/158 (20%)
sgk3XP_012820716.1 PX_domain 7..114 CDD:383026
STKc_SGK3 159..484 CDD:270755 52/265 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.