DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx6 and snx19a

DIOPT Version :9

Sequence 1:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001124114.1 Gene:snx19a / 100170806 ZFINID:ZDB-GENE-060526-204 Length:913 Species:Danio rerio


Alignment Length:374 Identity:73/374 - (19%)
Similarity:138/374 - (36%) Gaps:89/374 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSGATNGSGSATSPDSSSSAPATPAVLGENAL---------------HVEISDALSEKEKVKFTV 92
            |......|...|...:|:|.|.:   ||.::|               :::|:..::.||:...:.
Zfish   440 PECTAEESPVQTLTHTSNSIPRS---LGLDSLVFENLENLDRPVAIKNLQITKTITAKEQRSSST 501

  Fly    93 HTRTTLP------GFSKKD--------NNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPR---P 140
            |..|...      |.|:..        :.|.|::.||:.|..|:||..|....|.....|:   |
Zfish   502 HPYTLYTVKYETGGDSESSASDQPVPCHMVNRRYSEFLNLQTRLEERTDLKKAIKNVKGPKKLFP 566

  Fly   141 DFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHL 205
            |...|            |...::.:..:|:||:               |||:|.:.|.....:.:
Zfish   567 DLPFS------------NPDSDKVEARRSQLES---------------FLRKLCTIPEAANSEEV 604

  Fly   206 KVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVRDVNDFFENELQFLTEYHGHLREA 270
            :.||..:.|..|..:||.:  |..:..:.:...:.|.:|       |..:|.|..||.....|:.
Zfish   605 QEFLALNTDATASFQKKPS--GSRIDKMVENIVDTLKTA-------FPRSEPQSPTEEGDPQRKP 660

  Fly   271 ALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKG----NVETFVAKTAEIFERIKNLE----TRV 327
            .||.........:|......::.::::..|..:|    ::|.||.      |:.|.::    :..
Zfish   661 RLRFSSKIAPTLNVPSLQPNVTYSVSERCTVLRGFSLSDLEGFVE------EQEKQVDGGVRSHF 719

  Fly   328 ASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYE----AANRNLEK 372
            |..:.::....:....|.:|.|.|.:...:.||...:    ....|::|
Zfish   720 AGGRHVREQRPVEKRGRGADTALADIALNILCLLMKDQWSWLCTENIQK 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 33/171 (19%)
BAR_SNX5_6 228..452 CDD:153305 27/157 (17%)
snx19aNP_001124114.1 PXA 91..267 CDD:280373
PX_SNX19 484..611 CDD:132803 32/153 (21%)
Nexin_C 766..867 CDD:285792 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.