DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and CDA

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001776.1 Gene:CDA / 978 HGNCID:1712 Length:146 Species:Homo sapiens


Alignment Length:137 Identity:57/137 - (41%)
Similarity:77/137 - (56%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RELLEAALSARRCAYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCALAKGISEGEK 188
            ::||..:..|::.||.|||.|.||||...:.|||:.||||||..:..|.||||.|:.|.:|||.|
Human    16 QQLLVCSQEAKKSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYK 80

  Fly   189 KYTAGAVVAYHPDGFTTPCGVCRQFILEFIQNDIPIYIAKAPPPEQENCIPSIPDEAEVLVTSAY 253
            .:.|.|:.:...|.|.:|||.|||.:.||..| .|:|:.|             ||...:::| ..
Human    81 DFRAIAIASDMQDDFISPCGACRQVMREFGTN-WPVYMTK-------------PDGTYIVMT-VQ 130

  Fly   254 HLLPHSF 260
            .|||.||
Human   131 ELLPSSF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 55/135 (41%)
cytidine_deaminase-like 125..260 CDD:294193 55/134 (41%)
CDANP_001776.1 cyt_deam_tetra 16..142 CDD:273572 57/137 (42%)
Substrate binding 54..60 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1067
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1400471at2759
OrthoFinder 1 1.000 - - FOG0002702
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X545
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.