DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and CDD1

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_013346.1 Gene:CDD1 / 850946 SGDID:S000004235 Length:142 Species:Saccharomyces cerevisiae


Alignment Length:136 Identity:44/136 - (32%)
Similarity:67/136 - (49%) Gaps:14/136 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LLEAALSARRCAYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCALAKGISEGEKK- 189
            |..|||.|...:|:|||.|:||.:.......|:.|.|:||.:::...||||.|:.:.:..|.:. 
Yeast    14 LKRAALKACELSYSPYSHFRVGCSILTNNDVIFTGANVENASYSNCICAERSAMIQVLMAGHRSG 78

  Fly   190 YTAGAVVAYHPDGFTTPCGVCRQFILEFIQNDIPIYIAKAPPPEQENCIPSIPDEAEVLVTSAYH 254
            :....:.....|...:|||||||||.||:..|.||.:           :.|....::|:...  .
Yeast    79 WKCMVICGDSEDQCVSPCGVCRQFINEFVVKDFPIVM-----------LNSTGSRSKVMTMG--E 130

  Fly   255 LLPHSF 260
            |||.:|
Yeast   131 LLPMAF 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 43/134 (32%)
cytidine_deaminase-like 125..260 CDD:294193 43/134 (32%)
CDD1NP_013346.1 cyt_deam_tetra 12..141 CDD:273572 44/136 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346756
Domainoid 1 1.000 87 1.000 Domainoid score I1833
eggNOG 1 0.900 - - E1_COG0295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1489
Isobase 1 0.950 - 0 Normalized mean entropy S1067
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002702
OrthoInspector 1 1.000 - - otm46612
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X545
TreeFam 1 0.960 - -
1312.700

Return to query results.
Submit another query.