DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and AT4G29620

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_194691.1 Gene:AT4G29620 / 829083 AraportID:AT4G29620 Length:337 Species:Arabidopsis thaliana


Alignment Length:264 Identity:64/264 - (24%)
Similarity:95/264 - (35%) Gaps:90/264 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSDLQDELKRKELEKKMKELEMLQAKLARRQEQSGTKCAGGKIKNLRQKNLRKVLGKYMMTLEGF 79
            ||.|||      |..|.|.:.|.|.:.                             |::.|    
plant     8 LSHLQD------LVTKFKNMTMAQDRF-----------------------------KFVFT---- 33

  Fly    80 LCELARREARLNGDRGRASESENLPHPQMLEEYTVAFCAVGEDGRELLEAALSARRCAYAPYSKF 144
                 ..||.|.|    .::...||:                    |:..|:...|   ||.||:
plant    34 -----ANEAALEG----VTDPIRLPN--------------------LIRKAMCLAR---APISKY 66

  Fly   145 KVGAAFRAKCGRIYAGCNIENVAFTPG-----NCAERCALAKGISEGEKKYTAGAVVAYHPDG-- 202
            ||||..||..||:|.|.|::    .||     :......|...::...:|......||...||  
plant    67 KVGAVGRASSGRVYLGVNVD----FPGLPLHHSIHAEQFLVTNLALNYEKDLCKLAVAISTDGLE 127

  Fly   203 FTTPCGVCRQFILEFIQNDIPIYIAKAPPPEQEN------CIPSI-PDEAEVLVTSAYHLLPHSF 260
            |.||||.|.||::| :.|.:.:.|...|..|..:      .:|:: |..:..|:...|:.|..|.
plant   128 FGTPCGNCLQFLME-MSNALDMKILSKPKHEAGSFSSLRLLLPNVLPKGSPFLLEKRYNCLTLSG 191

  Fly   261 NSFE 264
            ::.|
plant   192 SAGE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 44/151 (29%)
cytidine_deaminase-like 125..260 CDD:294193 44/148 (30%)
AT4G29620NP_194691.1 PLN02182 1..337 CDD:177837 64/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4357
eggNOG 1 0.900 - - E1_COG0295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2658
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1400471at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3504
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X545
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.