DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and AT4G29600

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_194689.1 Gene:AT4G29600 / 829081 AraportID:AT4G29600 Length:307 Species:Arabidopsis thaliana


Alignment Length:167 Identity:52/167 - (31%)
Similarity:71/167 - (42%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 EEYTVAFCA-------VGEDGR--ELLEAALSARRCAYAPYSKFKVGAAFRAKCGRIYAGCNIEN 165
            ::|...|.|       |.|..|  :|:..|:|..|   .|.||:||||..||..||:|.|.|:| 
plant     5 DKYKFVFTAKEAASEGVTEPIRLPKLIRKAMSLAR---GPISKYKVGAVGRASSGRVYLGVNVE- 65

  Fly   166 VAFTPG-----NCAERCALAKGISEGEKKYTAGAVVAYHPD--GFTTPCGVCRQFILEFIQNDIP 223
               .||     :......|...::...:|......||...|  .|..|||.||||::| ..|::.
plant    66 ---FPGLPLHHSIHPEQFLVTNLALNSEKGLRQLAVAISSDCIEFGAPCGNCRQFLME-TSNELD 126

  Fly   224 IYIAKAPPPEQENCIPSIPDEAEVLVTSAYHLLPHSF 260
            |.|           :.....|||...:|...|||:.|
plant   127 IKI-----------LLKSKHEAEGSFSSLKLLLPYRF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 46/146 (32%)
cytidine_deaminase-like 125..260 CDD:294193 45/141 (32%)
AT4G29600NP_194689.1 cyt_deam_dimer 7..296 CDD:273573 52/165 (32%)
cytidine_deaminase 28..138 CDD:238610 39/128 (30%)
dCMP_cyt_deam_2 144..278 CDD:285429 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4357
eggNOG 1 0.900 - - E1_COG0295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2658
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1400471at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X545
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.