DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and AT4G29580

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001154274.1 Gene:AT4G29580 / 829079 AraportID:AT4G29580 Length:445 Species:Arabidopsis thaliana


Alignment Length:133 Identity:40/133 - (30%)
Similarity:56/133 - (42%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RQKNL-------RKVLGKYMMTLEGFLCELARREARLNGDRGRASESENLPHPQMLEEYTVAFCA 118
            ||:::       :|.|..|....:.|...|. .|.|.||        ..|.:|..:.:     |.
plant   134 RQRDMSLSTYLPQKYLSLYNEVPKYFFARLL-DENRNNG--------LTLINPNPIRD-----CL 184

  Fly   119 VGEDGRELLEAALSARRCAYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCALAKGI 183
            ..|....|...||.|...:||||||...|.|.....||:|:|.:||:|| .|...|.:.||...:
plant   185 DSEICNHLSCRALKAANRSYAPYSKSPSGVALMDFQGRVYSGWSIESVA-NPILGAAQAALVDFM 248

  Fly   184 SEG 186
            :.|
plant   249 TNG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 25/65 (38%)
cytidine_deaminase-like 125..260 CDD:294193 25/62 (40%)
AT4G29580NP_001154274.1 cyt_deam_dimer 7..297 CDD:273573 40/133 (30%)
cytidine_deaminase 38..136 CDD:238610 1/1 (100%)
dCMP_cyt_deam_2 140..279 CDD:285429 38/127 (30%)
DUF626 <376..>427 CDD:303072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4357
eggNOG 1 0.900 - - E1_COG0295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2658
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1400471at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X545
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.