DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and Cda

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_082452.1 Gene:Cda / 72269 MGIID:1919519 Length:146 Species:Mus musculus


Alignment Length:145 Identity:60/145 - (41%)
Similarity:80/145 - (55%) Gaps:16/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CAV-GEDGRELLEAALSARRCAYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCALA 180
            ||| .|..:.||.::..|::.||.|||:|.||||.....|||::||||||..:..|.||||.|:.
Mouse     8 CAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACYPLGVCAERTAIQ 72

  Fly   181 KGISEGEKKYTAGAVVAYHPDGFTTPCGVCRQFILEFIQNDIPIYIAKAPPPEQENCIPSIPDEA 245
            |.||||.|.:.|.|:.:...:.|.:|||.|||.:.|| ..|..:|:.|             || .
Mouse    73 KAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREF-GTDWAVYMTK-------------PD-G 122

  Fly   246 EVLVTSAYHLLPHSF 260
            ..:|.:...|||.||
Mouse   123 TFVVRTVQELLPASF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 54/137 (39%)
cytidine_deaminase-like 125..260 CDD:294193 54/134 (40%)
CdaNP_082452.1 cyt_deam_tetra 16..142 CDD:273572 56/137 (41%)
Substrate binding 54..56 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1067
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002702
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X545
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.