DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and cdaa

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001338644.1 Gene:cdaa / 559958 ZFINID:ZDB-GENE-170609-2 Length:139 Species:Danio rerio


Alignment Length:135 Identity:50/135 - (37%)
Similarity:74/135 - (54%) Gaps:15/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LLEAALSARRCAYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCALAKGISEGEKKY 190
            |::.:..||:.||.|||:|:||||.....|.::.|||:||..:|.|.||||.|::|.:|||...:
Zfish     9 LVQRSQEARKLAYCPYSRFRVGAAVLTSDGTVFTGCNVENACYTAGLCAERTAISKAVSEGHTTF 73

  Fly   191 TAGAVVAYHPDGFTTPCGVCRQFILEFIQNDIPIYIAKAPPPEQENCIPSIPDEAEVLVTSAYHL 255
            .|.|:.:...|.|.:|||.||||:.|| .:...:|::|.              :......:...|
Zfish    74 KAIAIASDLEDRFISPCGACRQFMREF-GSQWDVYLSKT--------------DGSFKQMTVEEL 123

  Fly   256 LPHSF 260
            ||.||
Zfish   124 LPCSF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 48/133 (36%)
cytidine_deaminase-like 125..260 CDD:294193 48/133 (36%)
cdaaNP_001338644.1 cyt_deam_tetra 9..133 CDD:273572 50/135 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1400471at2759
OrthoFinder 1 1.000 - - FOG0002702
OrthoInspector 1 1.000 - - mtm6519
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X545
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.