DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and CG8353

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001260233.1 Gene:CG8353 / 34123 FlyBaseID:FBgn0032002 Length:170 Species:Drosophila melanogaster


Alignment Length:168 Identity:87/168 - (51%)
Similarity:116/168 - (69%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SENLPHPQMLEEYTVAFCAVGEDGRELLEAALSARRCAYAPYSKFKVGAAFRAKC-GRIYAGCNI 163
            ::|...|:..|| .|.|.::....:|||.||...|:.||.|||.||||||||||. |:|:.|||:
  Fly     5 TKNFARPEKNEE-VVTFGSLDPSVQELLTAAFQVRQRAYVPYSGFKVGAAFRAKVDGKIFTGCNV 68

  Fly   164 ENVAFTPGNCAERCALAKGISEGEKKYTAGAVVAYHPDGFTTPCGVCRQFILEFIQNDIPIYIAK 228
            ||.|||||:||||.|:||.:|||..::.||||:||.|:.||||||||||||.||...|||||:|:
  Fly    69 ENAAFTPGSCAERTAIAKAVSEGATEFLAGAVLAYEPNVFTTPCGVCRQFIREFANADIPIYVAQ 133

  Fly   229 APP---PEQENCIPSIPDEAEVLVTSAYHLLPHSFNSF 263
            |..   .|::..:.|   :..|:.||.::|||.||:::
  Fly   134 AIDARIAEKQELLQS---DDPVMCTSIFNLLPSSFHTY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 79/141 (56%)
cytidine_deaminase-like 125..260 CDD:294193 79/138 (57%)
CG8353NP_001260233.1 cyt_deam_tetra 28..165 CDD:273572 79/139 (57%)
cytidine_deaminase-like 29..167 CDD:294193 81/140 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473015
Domainoid 1 1.000 50 1.000 Domainoid score I4357
eggNOG 1 0.900 - - E1_COG0295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2658
Isobase 1 0.950 - 0 Normalized mean entropy S1067
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1400471at2759
OrthoFinder 1 1.000 - - FOG0002702
OrthoInspector 1 1.000 - - mtm6519
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - P PTHR11644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X545
1211.750

Return to query results.
Submit another query.