DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and cdd1

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_594321.1 Gene:cdd1 / 2541551 PomBaseID:SPAC1556.04c Length:133 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:49/143 - (34%)
Similarity:69/143 - (48%) Gaps:22/143 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 EDGRELLEAALSARRCAYAPYSKFKVGAAFRAKCGRIYA-GCNIENVAFTPGN--CAERCALAKG 182
            ||..:|.:....:.:.:|.|||.|.|||...:.....|. |.|:||.::  ||  ||||.|:.|.
pombe     4 EDIEKLFQEVKKSLQYSYCPYSNFAVGACVVSDDKNTYIYGANVENASY--GNCICAERVAITKA 66

  Fly   183 ISEGEKKYTAGAVVAYHPDGFTTPCGVCRQFILEFIQNDIPIYIAKAPPPEQENCIPSIPDEAEV 247
            :|.|..|:.|..|::  ..|..||||:|||.|.|| ..||.:|:              ..|:...
pombe    67 VSMGYTKFMAIGVMS--AKGRVTPCGICRQVIREF-SKDINVYM--------------FHDDGGY 114

  Fly   248 LVTSAYHLLPHSF 260
            .:.:...|||.||
pombe   115 DMKTIEELLPDSF 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 46/140 (33%)
cytidine_deaminase-like 125..260 CDD:294193 45/137 (33%)
cdd1NP_594321.1 cytidine_deaminase-like 5..133 CDD:294193 48/142 (34%)
cyt_deam_tetra 7..132 CDD:273572 47/140 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2121
eggNOG 1 0.900 - - E1_COG0295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I1728
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002702
OrthoInspector 1 1.000 - - otm47080
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X545
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.