DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8349 and cdd-2

DIOPT Version :9

Sequence 1:NP_609197.2 Gene:CG8349 / 34124 FlyBaseID:FBgn0032003 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001370695.1 Gene:cdd-2 / 186044 WormBaseID:WBGene00000392 Length:166 Species:Caenorhabditis elegans


Alignment Length:145 Identity:53/145 - (36%)
Similarity:78/145 - (53%) Gaps:21/145 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ELLEAALSARRCAYAPYSKFKVGAAFRAKCGRIYAGCNIENVAFTPGNCAERCALAKGISEGEKK 189
            ||:..|.:|.:.|:.|||||.||||...:.|.|..|||:||.::....||||.|:...:|:|..|
 Worm    14 ELVHLARAAMKRAHCPYSKFPVGAALLTESGEIVQGCNVENASYGGTICAERSAIVSAVSQGYTK 78

  Fly   190 YTAGAVVAYHPDGFTTPCGVCRQFILEFIQNDIPIYIAKAPPPEQENCIPSIPDEAEVLVTSAYH 254
            :.|.|||....:. .:|||:||||::||  .|..:.:..|             ...::|:||...
 Worm    79 FRAIAVVTELSEP-ASPCGLCRQFLVEF--GDYKVVVGTA-------------SNNKILITSTRA 127

  Fly   255 LLPHSF-----NSFE 264
            |||.:|     ::||
 Worm   128 LLPFAFTPESLDTFE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8349NP_609197.2 Cdd 122..260 CDD:223372 50/134 (37%)
cytidine_deaminase-like 125..260 CDD:294193 50/134 (37%)
cdd-2NP_001370695.1 cytidine_deaminase-like 14..139 CDD:412274 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165758
Domainoid 1 1.000 99 1.000 Domainoid score I4443
eggNOG 1 0.900 - - E1_COG0295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I3525
Isobase 1 0.950 - 0 Normalized mean entropy S1067
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1400471at2759
OrthoFinder 1 1.000 - - FOG0002702
OrthoInspector 1 1.000 - - mtm4818
orthoMCL 1 0.900 - - OOG6_100962
Panther 1 1.100 - - O PTHR11644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X545
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.710

Return to query results.
Submit another query.