powered by:
Protein Alignment Ssb-c31a and AT5G42060
DIOPT Version :9
Sequence 1: | NP_477136.1 |
Gene: | Ssb-c31a / 34120 |
FlyBaseID: | FBgn0015299 |
Length: | 110 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_199021.1 |
Gene: | AT5G42060 / 834211 |
AraportID: | AT5G42060 |
Length: | 92 |
Species: | Arabidopsis thaliana |
Alignment Length: | 59 |
Identity: | 13/59 - (22%) |
Similarity: | 21/59 - (35%) |
Gaps: | 15/59 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 LEGLRQVRINEFRGRKSVDIREFYDKGGQILPGKKGISLSLIQWKKLLEVAEEVTRAIE 109
||.....:|.|.:.|:...:: :.|.|.|....:.|.|||...:|
plant 27 LESSNLYKITEIKAREEASLK---------------LDLDLSQDPYKVIVKEEVENFLE 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ssb-c31a | NP_477136.1 |
PC4 |
55..99 |
CDD:280405 |
6/43 (14%) |
AT5G42060 | NP_199021.1 |
DEK_C |
17..69 |
CDD:400903 |
12/56 (21%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13215 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.