DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssb-c31a and AT5G42060

DIOPT Version :9

Sequence 1:NP_477136.1 Gene:Ssb-c31a / 34120 FlyBaseID:FBgn0015299 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_199021.1 Gene:AT5G42060 / 834211 AraportID:AT5G42060 Length:92 Species:Arabidopsis thaliana


Alignment Length:59 Identity:13/59 - (22%)
Similarity:21/59 - (35%) Gaps:15/59 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LEGLRQVRINEFRGRKSVDIREFYDKGGQILPGKKGISLSLIQWKKLLEVAEEVTRAIE 109
            ||.....:|.|.:.|:...::               :.|.|.|....:.|.|||...:|
plant    27 LESSNLYKITEIKAREEASLK---------------LDLDLSQDPYKVIVKEEVENFLE 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssb-c31aNP_477136.1 PC4 55..99 CDD:280405 6/43 (14%)
AT5G42060NP_199021.1 DEK_C 17..69 CDD:400903 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13215
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.