DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssb-c31a and AT5G09240

DIOPT Version :9

Sequence 1:NP_477136.1 Gene:Ssb-c31a / 34120 FlyBaseID:FBgn0015299 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_850798.2 Gene:AT5G09240 / 830783 AraportID:AT5G09240 Length:138 Species:Arabidopsis thaliana


Alignment Length:127 Identity:32/127 - (25%)
Similarity:46/127 - (36%) Gaps:45/127 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KAKESDAPNSDPKDSGENGATS---------------WTLEGLRQVRINEFRGRKSVDIREFYDK 76
            |.|:.|...||.:|..|..|..               ..|:..|:|.:....||..:.||:|:.|
plant     6 KRKDEDVRASDDRDESETHAPPKKVAKPADEIEDIFICNLDKNRRVFVRNCNGRIWIAIRQFFVK 70

  Fly    77 GGQILP--GKKGISLS----------------------------LIQWKKLLEVAEEVTRAI 108
            .|..||  .|:|||||                            |:||..|....|::.:|:
plant    71 DGITLPCNSKQGISLSLEQVFTSLFHCLCLPHVHMSCLLHETFFLMQWNDLRNHEEDIDKAL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssb-c31aNP_477136.1 PC4 55..99 CDD:280405 21/73 (29%)
AT5G09240NP_850798.2 PC4 47..89 CDD:280405 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4268
eggNOG 1 0.900 - - E1_KOG2712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2502
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1616655at2759
OrthoFinder 1 1.000 - - FOG0003133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102997
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.