DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssb-c31a and KELP

DIOPT Version :9

Sequence 1:NP_477136.1 Gene:Ssb-c31a / 34120 FlyBaseID:FBgn0015299 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001078372.1 Gene:KELP / 826690 AraportID:AT4G10920 Length:165 Species:Arabidopsis thaliana


Alignment Length:111 Identity:37/111 - (33%)
Similarity:51/111 - (45%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTKKKDSSSDSDSGPDDRIKPASKKAKESDAPNSDPKDSGENGATSWTLEGLRQVRINEFRGRKS 67
            :..|::...|.|.|         |..||.|       |.|:  .....|...|:|.|.||:|:..
plant    71 QVNKEEEDGDKDCG---------KGNKEFD-------DDGD--LIICRLSDKRRVTIQEFKGKSL 117

  Fly    68 VDIREFYDKGGQILPGKKGISLSLIQW---KKLLEVAEEVTRAIEN 110
            |.|||:|.|.|:.||..|||||:..||   ||.:...|...:.:|:
plant   118 VSIREYYKKDGKELPTSKGISLTDEQWSTFKKNMPAIENAVKKMES 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssb-c31aNP_477136.1 PC4 55..99 CDD:280405 24/46 (52%)
KELPNP_001078372.1 DEK_C 13..59 CDD:285919
PC4 104..150 CDD:280405 23/45 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4268
eggNOG 1 0.900 - - E1_KOG2712
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1616655at2759
OrthoFinder 1 1.000 - - FOG0003133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102997
Panther 1 1.100 - - LDO PTHR13215
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7643
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.