DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssb-c31a and KELP

DIOPT Version :10

Sequence 1:NP_477136.1 Gene:Ssb-c31a / 34120 FlyBaseID:FBgn0015299 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_192830.1 Gene:KELP / 826690 AraportID:AT4G10920 Length:165 Species:Arabidopsis thaliana


Alignment Length:111 Identity:37/111 - (33%)
Similarity:51/111 - (45%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTKKKDSSSDSDSGPDDRIKPASKKAKESDAPNSDPKDSGENGATSWTLEGLRQVRINEFRGRKS 67
            :..|::...|.|.|         |..||.|       |.|:  .....|...|:|.|.||:|:..
plant    71 QVNKEEEDGDKDCG---------KGNKEFD-------DDGD--LIICRLSDKRRVTIQEFKGKSL 117

  Fly    68 VDIREFYDKGGQILPGKKGISLSLIQW---KKLLEVAEEVTRAIEN 110
            |.|||:|.|.|:.||..|||||:..||   ||.:...|...:.:|:
plant   118 VSIREYYKKDGKELPTSKGISLTDEQWSTFKKNMPAIENAVKKMES 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssb-c31aNP_477136.1 PC4 49..99 CDD:460501 25/52 (48%)
KELPNP_192830.1 DEK_C 13..59 CDD:462592
PC4 99..150 CDD:460501 24/50 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.