DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssb-c31a and sub1b

DIOPT Version :9

Sequence 1:NP_477136.1 Gene:Ssb-c31a / 34120 FlyBaseID:FBgn0015299 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001002505.1 Gene:sub1b / 436778 ZFINID:ZDB-GENE-040718-209 Length:124 Species:Danio rerio


Alignment Length:125 Identity:44/125 - (35%)
Similarity:70/125 - (56%) Gaps:19/125 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKTKK---KDSSSDSDSGPDDRI---------KPASK-KAKESDAPNSDPK--DSGENGATSWT 50
            |||:|:   ..|.|:||...:.::         |||.| |:.||..|:...|  .|.:|   .:.
Zfish     1 MPKSKEVLSSTSGSESDGDAETKVKRKKPSTPEKPAKKQKSGESSKPSGSAKTEKSSDN---MFQ 62

  Fly    51 LEGLRQVRINEFRGRKSVDIREFY-DKGGQILPGKKGISLSLIQWKKLLEVAEEVTRAIE 109
            :..||.|.:.:|:|:..:||||:: |:.|::.||||||||:..||.:|.|...::..||:
Zfish    63 IGKLRYVSVRDFKGKVLIDIREYWMDQAGEMKPGKKGISLNPEQWSQLKEQMSDIDDAIK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssb-c31aNP_477136.1 PC4 55..99 CDD:280405 21/44 (48%)
sub1bNP_001002505.1 PC4 67..112 CDD:280405 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11693
eggNOG 1 0.900 - - E1_KOG2712
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5335
OMA 1 1.010 - - QHG59025
OrthoDB 1 1.010 - - D1616655at2759
OrthoFinder 1 1.000 - - FOG0003133
OrthoInspector 1 1.000 - - otm25924
orthoMCL 1 0.900 - - OOG6_102997
Panther 1 1.100 - - O PTHR13215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1483
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.