DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssb-c31a and sub1

DIOPT Version :9

Sequence 1:NP_477136.1 Gene:Ssb-c31a / 34120 FlyBaseID:FBgn0015299 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_594042.1 Gene:sub1 / 2542309 PomBaseID:SPAC16A10.02 Length:136 Species:Schizosaccharomyces pombe


Alignment Length:85 Identity:35/85 - (41%)
Similarity:51/85 - (60%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KPASKKAKESDAPNSDPKDSGENGATSWTLEGLRQVRI--NEFRGRKSVDIREFYDKGGQILPGK 84
            |.:|||      |.::.:...|   ..|.|....:.||  :||||.:.|.|||:|:|.|.:||||
pombe    12 KASSKK------PKTEKQSDHE---LHWALNETEKKRITLSEFRGTRYVHIREYYEKDGDMLPGK 67

  Fly    85 KGISLSLIQWKKLLEVAEEV 104
            |||:|::.:||||.::..||
pombe    68 KGIALNINEWKKLKQLIHEV 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssb-c31aNP_477136.1 PC4 55..99 CDD:280405 25/45 (56%)
sub1NP_594042.1 PC4 36..83 CDD:280405 25/46 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3089
eggNOG 1 0.900 - - E1_KOG2712
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1987
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003133
OrthoInspector 1 1.000 - - oto100621
orthoMCL 1 0.900 - - OOG6_102997
Panther 1 1.100 - - LDO PTHR13215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1483
SonicParanoid 1 1.000 - - X7643
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.