DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssb-c31a and Sub1

DIOPT Version :9

Sequence 1:NP_477136.1 Gene:Ssb-c31a / 34120 FlyBaseID:FBgn0015299 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_035424.1 Gene:Sub1 / 20024 MGIID:104811 Length:127 Species:Mus musculus


Alignment Length:124 Identity:38/124 - (30%)
Similarity:64/124 - (51%) Gaps:16/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKTKKKDSSSDSDSGPDDRIKPASKKAKE---------------SDAPNSDPKDSGENGATSWT 50
            |||:|:..|||.|.|..|..::...|:.|:               |.|..|..:.|.......:.
Mouse     1 MPKSKELVSSSSSGSDSDSEVEKKLKRKKQAVPEKPVKKQKPGETSRALASSKQSSSSRDDNMFQ 65

  Fly    51 LEGLRQVRINEFRGRKSVDIREFY-DKGGQILPGKKGISLSLIQWKKLLEVAEEVTRAI 108
            :..:|.|.:.:|:|:..:||||:: |..|::.||:|||||::.||.:|.|...::..|:
Mouse    66 IGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQISDIDDAV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssb-c31aNP_477136.1 PC4 55..99 CDD:280405 20/44 (45%)
Sub1NP_035424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 16/61 (26%)
Regulatory 1..50 14/48 (29%)
PC4 68..115 CDD:396692 20/46 (43%)
Interaction with ssDNA. /evidence=ECO:0000250 77..101 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 1 0.900 - - E1_KOG2712
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5374
Isobase 1 0.950 - 0 Normalized mean entropy S1248
OMA 1 1.010 - - QHG59025
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003133
OrthoInspector 1 1.000 - - oto92264
orthoMCL 1 0.900 - - OOG6_102997
Panther 1 1.100 - - LDO PTHR13215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1483
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.810

Return to query results.
Submit another query.