DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssb-c31a and T13F2.2

DIOPT Version :9

Sequence 1:NP_477136.1 Gene:Ssb-c31a / 34120 FlyBaseID:FBgn0015299 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_501750.1 Gene:T13F2.2 / 188475 WormBaseID:WBGene00011743 Length:124 Species:Caenorhabditis elegans


Alignment Length:106 Identity:35/106 - (33%)
Similarity:60/106 - (56%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTKKKDSSSDSDSGPDDRIKPASKKAKESDAPNSDPKDSGENGATSWTLEGLRQVRINEFRGRKS 67
            |:||:.|.:..:.      |...||||..:..:...|||  :|...:.:..||...:::|:|::.
 Worm    25 KSKKRQSEAVEEE------KQEVKKAKNEEEVSGRLKDS--DGNEMFEIGNLRYATVSKFKGKEY 81

  Fly    68 VDIREFY-DKGGQ-ILPGKKGISLSLIQWKKLLEVAEEVTR 106
            |:|||:| |:..| ::|.:||||||..||..|.::..|:.:
 Worm    82 VNIREYYIDRDSQKMMPSRKGISLSKAQWANLKDLIPEIDK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ssb-c31aNP_477136.1 PC4 55..99 CDD:280405 20/45 (44%)
T13F2.2NP_501750.1 PC4 69..116 CDD:280405 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I8429
eggNOG 1 0.900 - - E1_KOG2712
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4050
Isobase 1 0.950 - 0 Normalized mean entropy S1248
OMA 1 1.010 - - QHG59025
OrthoDB 1 1.010 - - D1616655at2759
OrthoFinder 1 1.000 - - FOG0003133
OrthoInspector 1 1.000 - - oto19535
orthoMCL 1 0.900 - - OOG6_102997
Panther 1 1.100 - - LDO PTHR13215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1483
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.