DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and CDY2A

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_004816.1 Gene:CDY2A / 9426 HGNCID:1810 Length:541 Species:Homo sapiens


Alignment Length:112 Identity:33/112 - (29%)
Similarity:61/112 - (54%) Gaps:7/112 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EEYAVEKIIDRRVRK-GKVEYYLKWKGYPETENTWEPENNL-DCQDLIQQYEASRKDEEKSAASK 84
            :|:.||.|:|:|..| |..:|.::||||.:.::|||||.:| :|:..:..:  :|:..||   .|
Human     4 QEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCVHDF--NRRQTEK---QK 63

  Fly    85 KDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAE 131
            |...:::::......|..:|.||.:......|..|..:|..|:.:.:
Human    64 KLTWTTTSRIFSNNARRRTSRSTKANYSKNSPKTPVTDKHHRSKNCK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 19/49 (39%)
ChSh 141..202 CDD:197638
CDY2ANP_004816.1 CHROMO 5..58 CDD:214605 21/54 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..104 7/31 (23%)
crotonase-like 287..483 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.