DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and CDYL

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001355054.1 Gene:CDYL / 9425 HGNCID:1811 Length:598 Species:Homo sapiens


Alignment Length:179 Identity:47/179 - (26%)
Similarity:84/179 - (46%) Gaps:36/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DNP-ESSAKVSDAE---EEEEEYAVEKIIDRRV-RKGKVEYYLKWKGYPETENTWEPENNL-DCQ 64
            |.| :.|..||..:   ::.....||:|:|:|. :|||.||.::||||...::|||||.:| :|:
Human    39 DGPSDPSISVSSEQSGAQQPPALQVERIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCE 103

  Fly    65 DLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTST---------------------A 108
            :.|..:.....:::|.:...:...:|...|::...|:::|..:                     |
Human   104 EYIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALVIGKDHESKNSQLFA 168

  Fly   109 SKRKSEEPTAPSGNKSKRTTDAEQDTI-------PVSGSTGFDRGLEAE 150
            :.:|..:.|||| ..|::..|..:..|       ||...|..| |.::|
Human   169 ASQKFRKNTAPS-LSSRKNMDLAKSGIKILVPKSPVKSRTAVD-GFQSE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/49 (45%)
ChSh 141..202 CDD:197638 4/10 (40%)
CDYLNP_001355054.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 11/36 (31%)
Interaction with EZH2. /evidence=ECO:0000269|PubMed:22009739 61..309 42/157 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..149 5/36 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..226 4/13 (31%)
Acetyl-CoA-binding domain. /evidence=ECO:0000255 362..594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.