DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Skadu

DIOPT Version :10

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001162985.1 Gene:Skadu / 8673966 FlyBaseID:FBgn0259922 Length:133 Species:Drosophila melanogaster


Alignment Length:103 Identity:30/103 - (29%)
Similarity:52/103 - (50%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTF 164
            :.:.:.||.|.|.:...|.....| |.::|. .:..||.....|:||.:.|.||....|..:..|
  Fly    21 KRTCNLSTISPRSTLVQTVKKPVK-KFSSDL-ANLPPVPAIDAFERGYQVESILDMVQNIHKEQF 83

  Fly   165 L-IQFKGVDQAEMVPSSVANEKIPRMVIHFYEERL-SW 200
            | |:|..:.:.|:||..:|.:.:|.::..||:|.: :|
  Fly    84 LYIKFTNLIEPELVPLELALQHVPHLLSDFYKEYVQAW 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CD_HP1a_insect 24..72 CDD:349300
CSD_HP1a_insect 146..198 CDD:349305 17/52 (33%)
SkaduNP_001162985.1 CSD 66..116 CDD:349275 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.