DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Skadu

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001162985.1 Gene:Skadu / 8673966 FlyBaseID:FBgn0259922 Length:133 Species:Drosophila melanogaster


Alignment Length:103 Identity:30/103 - (29%)
Similarity:52/103 - (50%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTF 164
            :.:.:.||.|.|.:...|.....| |.::|. .:..||.....|:||.:.|.||....|..:..|
  Fly    21 KRTCNLSTISPRSTLVQTVKKPVK-KFSSDL-ANLPPVPAIDAFERGYQVESILDMVQNIHKEQF 83

  Fly   165 L-IQFKGVDQAEMVPSSVANEKIPRMVIHFYEERL-SW 200
            | |:|..:.:.|:||..:|.:.:|.::..||:|.: :|
  Fly    84 LYIKFTNLIEPELVPLELALQHVPHLLSDFYKEYVQAW 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991
ChSh 141..202 CDD:197638 20/62 (32%)
SkaduNP_001162985.1 ChSh 68..116 CDD:294039 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.