DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and NEW1

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_015098.1 Gene:NEW1 / 855875 SGDID:S000006147 Length:1196 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:25/81 - (30%)
Similarity:43/81 - (53%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKI--DNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNL---D 62
            :||  |..|...|..|.::...:.|:|.|:.|:..|...:|.:|||.:....|:|.|::.|   .
Yeast   919 RKISEDEKEMMTKEIDIDDGRGKRAIEAIVGRQKLKKSFQYEVKWKYWKPKYNSWVPKDVLVEHG 983

  Fly    63 CQDLIQQY---EASRK 75
            .:.|:|::   ||||:
Yeast   984 FEKLVQKFDDHEASRE 999

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 15/53 (28%)
ChSh 141..202 CDD:197638
NEW1NP_015098.1 HEAT repeat 183..214 CDD:293787
HEAT repeat 224..253 CDD:293787
HEAT repeat 264..291 CDD:293787
Uup 572..1122 CDD:223562 25/81 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S3980
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.