DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and PKL

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001324293.1 Gene:PKL / 817055 AraportID:AT2G25170 Length:1410 Species:Arabidopsis thaliana


Alignment Length:209 Identity:44/209 - (21%)
Similarity:72/209 - (34%) Gaps:75/209 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SAKVSDAEEEE---------EEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDL 66
            |.::..:|::|         ::.|::|::||                                ||
plant   791 SKELFASEDDEAGKSGKIHYDDAAIDKLLDR--------------------------------DL 823

  Fly    67 IQQYEASRKDEEKSAASKKDR-------PSSSAKAKETQGRASSSTSTASK-------------- 110
            ::..|.|..|||::...|..:       ..:.|.|.|.|..|:.|.|:|..              
plant   824 VEAEEVSVDDEEENGFLKAFKVANFEYIDENEAAALEAQRVAAESKSSAGNSDRASYWEELLKDK 888

  Fly   111 ---RKSEEPTAPSGNK--SKRTTDAEQDTIPVSG----STGFDRGLEAEKILGASDNNGRLTFLI 166
               .::||..|....|  .|:....|:|.:  :|    |:..|...|||...|.:...|..|...
plant   889 FELHQAEELNALGKRKRSRKQLVSIEEDDL--AGLEDVSSDGDESYEAESTDGEAAGQGVQTGRR 951

  Fly   167 QF--KGVDQAEMVP 178
            .:  ||.|..|..|
plant   952 PYRRKGRDNLEPTP 965

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 6/47 (13%)
ChSh 141..202 CDD:197638 12/40 (30%)
PKLNP_001324293.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.