Sequence 1: | NP_476755.1 | Gene: | Su(var)205 / 34119 | FlyBaseID: | FBgn0003607 | Length: | 206 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001019586.1 | Gene: | cbx8b / 799361 | ZFINID: | ZDB-GENE-050522-325 | Length: | 361 | Species: | Danio rerio |
Alignment Length: | 282 | Identity: | 62/282 - (21%) |
---|---|---|---|
Similarity: | 94/282 - (33%) | Gaps: | 102/282 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK 85
Fly 86 D--------RPSSSAKAKETQGRASSS-------------------------------TSTAS-- 109
Fly 110 ---KRKSEEPTAPSGNKSKRTTDAEQDTIPVSG-------STGFDRGLEAEKILGASDN------ 158
Fly 159 ------------------NGRLTFLIQFKGVD------QAEMVPSSVANEKIPRMVI-------- 191
Fly 192 -----------HFYEERLSWYS 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Su(var)205 | NP_476755.1 | CHROMO | 24..72 | CDD:237991 | 21/47 (45%) |
ChSh | 141..202 | CDD:197638 | 18/109 (17%) | ||
cbx8b | NP_001019586.1 | Chromo | 14..57 | CDD:278797 | 20/42 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628171at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |