DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cbx6a

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_021325056.1 Gene:cbx6a / 799294 ZFINID:ZDB-GENE-040808-26 Length:488 Species:Danio rerio


Alignment Length:234 Identity:60/234 - (25%)
Similarity:93/234 - (39%) Gaps:82/234 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEE---------- 78
            :|.|.|:..|||||.:||.:||||:....:|||||.|:....||:.:|...:::|          
Zfish    11 FAAEAILKSRVRKGHIEYLVKWKGWALKHSTWEPEENILDDRLIKAFEQKEREQELYGPKKRGPK 75

  Fly    79 ------KSAASKKDRP-------------------SSSAKAKETQGRASSSTSTA---------- 108
                  |:.|...|||                   ||||.:...|..:|||.|||          
Zfish    76 PKNFVLKARAQSGDRPRSSYTRRTPSCTTAKPPTASSSASSATPQPSSSSSHSTAPTPRVHSLAA 140

  Fly   109 --------------SKR--KSEEPTAPS-GNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGAS 156
                          |:|  ...:|.|.| |:.|:.......:|:.:     .:|.::..::    
Zfish   141 AHKLKKDIHRCHMMSRRPLPRSDPLANSTGSSSRHPISPFSETVRI-----LNRRVKPREV---- 196

  Fly   157 DNNGRLTFLIQFKGVDQAE-------MVPSSVANE-KIP 187
             ..||:  ::..|.:|::|       ..|.|.|.. |||
Zfish   197 -KRGRI--ILNLKVIDKSENGGMTSRRTPQSFAGRAKIP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/47 (47%)
ChSh 141..202 CDD:197638 12/55 (22%)
cbx6aXP_021325056.1 Chromo 11..60 CDD:306815 23/48 (48%)
CBX7_C 432..463 CDD:319236
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.