DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Cdyl2

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_083717.1 Gene:Cdyl2 / 75796 MGIID:1923046 Length:503 Species:Mus musculus


Alignment Length:200 Identity:57/200 - (28%)
Similarity:86/200 - (43%) Gaps:50/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YAVEKIIDRRV-RKGKVEYYLKWKGYPETENTWEPENN-LDCQDLIQQYEASRKDEEKSAASKKD 86
            |.||:|:|:|. :|||.||.::||||..||:|||||:: |.|::.|.::......::|...|.|.
Mouse     7 YEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHLSKDKRVKSGKQ 71

  Fly    87 --------------------RPSSSAKAKETQGRASSSTSTASKRK----SEEPTAPSGNKSKRT 127
                                ||....|:|.:..:.....|..|:.|    .:.|...:...|.||
Mouse    72 AGASKLLRDARGLPVERLSHRPLEPGKSKPSSHKRKRVNSPLSRPKKGSSGKAPDRATKTVSYRT 136

  Fly   128 TDAEQDTIPV--------SGSTG-------FDRG-----LEAEKILG---ASDNNGRLTFLIQFK 169
            |.:....:|:        :|..|       |..|     ||....||   |||.:|..:.|:: .
Mouse   137 TPSGLQIMPLKKAQNGLENGDAGSEKDESHFGNGSHQPDLELNDQLGEQEASDCDGTHSALVE-N 200

  Fly   170 GVDQA 174
            ||..|
Mouse   201 GVGSA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 25/49 (51%)
ChSh 141..202 CDD:197638 14/48 (29%)
Cdyl2NP_083717.1 CHROMO 7..55 CDD:214605 25/47 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..177 19/110 (17%)
crotonase-like 249..445 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.