Sequence 1: | NP_476755.1 | Gene: | Su(var)205 / 34119 | FlyBaseID: | FBgn0003607 | Length: | 206 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083717.1 | Gene: | Cdyl2 / 75796 | MGIID: | 1923046 | Length: | 503 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 57/200 - (28%) |
---|---|---|---|
Similarity: | 86/200 - (43%) | Gaps: | 50/200 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 YAVEKIIDRRV-RKGKVEYYLKWKGYPETENTWEPENN-LDCQDLIQQYEASRKDEEKSAASKKD 86
Fly 87 --------------------RPSSSAKAKETQGRASSSTSTASKRK----SEEPTAPSGNKSKRT 127
Fly 128 TDAEQDTIPV--------SGSTG-------FDRG-----LEAEKILG---ASDNNGRLTFLIQFK 169
Fly 170 GVDQA 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Su(var)205 | NP_476755.1 | CHROMO | 24..72 | CDD:237991 | 25/49 (51%) |
ChSh | 141..202 | CDD:197638 | 14/48 (29%) | ||
Cdyl2 | NP_083717.1 | CHROMO | 7..55 | CDD:214605 | 25/47 (53%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 66..177 | 19/110 (17%) | |||
crotonase-like | 249..445 | CDD:119339 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1911 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |