DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cbx3a

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_005173826.1 Gene:cbx3a / 751689 ZFINID:ZDB-GENE-030131-1158 Length:177 Species:Danio rerio


Alignment Length:207 Identity:84/207 - (40%)
Similarity:119/207 - (57%) Gaps:37/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQD 65
            ||||     .:.|.....:|.||:.|||::|:||..||||::|||||:.:.:||||||.||||.:
Zfish     4 MGKK-----QAGKSKKEVQEIEEFVVEKVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENLDCPE 63

  Fly    66 LIQQYEASRKD-EEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTD 129
            ||..:..|:|. .||..|.|:   .||....||:       .:.:|||.|....|          
Zfish    64 LIAAFLESQKGVVEKPEAVKR---KSSTDEPETE-------ESKAKRKKEMSDKP---------- 108

  Fly   130 AEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFY 194
                       .||.|.||.|:|:||:|::|.|.||:::|..|:|::||:..||.:.|::||.||
Zfish   109 -----------RGFARNLEPERIIGATDSSGELMFLMKWKDSDEADLVPAREANTRCPQIVIAFY 162

  Fly   195 EERLSWYSDNED 206
            ||||:|:|..||
Zfish   163 EERLTWHSCPED 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 27/47 (57%)
ChSh 141..202 CDD:197638 31/60 (52%)
cbx3aXP_005173826.1 Chromo 23..71 CDD:278797 27/47 (57%)
Chromo_shadow 116..167 CDD:279701 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.