DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and LOC688980

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_038964775.1 Gene:LOC688980 / 688980 RGDID:1582927 Length:183 Species:Rattus norvegicus


Alignment Length:206 Identity:82/206 - (39%)
Similarity:118/206 - (57%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQD 65
            ||||.:.  .|.||.:|  |.||:.|:|.:||.|..|||||:|||||:.:.:||||||.||||.:
  Rat    11 MGKKQNG--KSKKVEEA--EPEEFVVDKELDRHVVNGKVEYFLKWKGFTDADNTWEPEENLDCPE 71

  Fly    66 LIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDA 130
            |||.:...:|     |..:||                     .:||||...:...|:|.|:..||
  Rat    72 LIQAFLNYQK-----AGKEKD---------------------GTKRKSLSDSESDGSKLKKKRDA 110

  Fly   131 EQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYE 195
                  .....||.|||:.|:|:||:|::|.|.||:::|..|:|::|.:...|.|.|::||.|.:
  Rat   111 ------ADKPRGFARGLDFERIIGATDSSGELMFLMKWKDSDEADLVLAKEVNMKCPQIVIAFCK 169

  Fly   196 ERLSWYSDNED 206
            |||:|:|..:|
  Rat   170 ERLTWHSCPKD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 28/47 (60%)
ChSh 141..202 CDD:197638 28/60 (47%)
LOC688980XP_038964775.1 CD_HP1gamma_Cbx3 29..78 CDD:349299 29/48 (60%)
CD_CSD 116..173 CDD:421697 26/56 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.