DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Su(var)205 and Suv39h2

DIOPT Version :9

Sequence 1:	NP_476755.1	Gene:	Su(var)205 / 34119	FlyBaseID:	FBgn0003607	Length:	206	Species:	Drosophila melanogaster
Sequence 2:	NP_073561.2	Gene:	Suv39h2 / 64707	MGIID:	1890396	Length:	477	Species:	Mus musculus

Alignment Length:	84	Identity:	37/84 - (44%)
Similarity:	50/84 - (59%)	Gaps:	12/84 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    24 YAVEKIIDRRVRKGKVEYYL-KWKGYPETENTWEPENNLDCQDLIQQYEASRK----DEEKSAA- 82
            |.||.:.|.:|.|| ||||| ||||:|::.|||||..||.|..|::|:...:|    .|.|..|
Mouse   118 YEVEYLCDYKVAKG-VEYYLVKWKGWPDSTNTWEPLRNLRCPQLLRQFSDDKKTYLAQERKCKAV 181

  Fly    83 -SKKDRPSSS----AKAKE 96
             ||..:|:.:    .|||:
Mouse   182 NSKSLQPAIAEYIVQKAKQ 200

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Su(var)205	NP_476755.1	CHROMO	24..72	CDD:237991	27/48 (56%)
Su(var)205	NP_476755.1	ChSh	141..202	CDD:197638
Suv39h2	NP_073561.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..59
		Chromo	119..164	CDD:278797	25/45 (56%)
		Pre-SET	221..309	CDD:282838
		SET	317..446	CDD:214614
		S-adenosyl-L-methionine binding. /evidence=ECO:0000250	328..330
		S-adenosyl-L-methionine binding. /evidence=ECO:0000250	397..398
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910