DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cbx4

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_991312.1 Gene:cbx4 / 573110 ZFINID:ZDB-GENE-040329-2 Length:477 Species:Danio rerio


Alignment Length:310 Identity:60/310 - (19%)
Similarity:105/310 - (33%) Gaps:136/310 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNL------------------------ 61
            |..:|||.|..:|:|||::||.:||:|:....||||||.|:                        
Zfish     8 EHVFAVEGIEKKRLRKGRMEYLVKWRGWSPKYNTWEPEENILDPRLLVAFQNRERQEQMVGYRKR 72

  Fly    62 --------------------------------------------------------------DCQ 64
                                                                          .|:
Zfish    73 GPKPKHPLIQLPAFARRSSILGGLQDTSLDEENQPKVDSLQMHRSRPQHYQLNSKKHHQYQPSCK 137

  Fly    65 DL-IQQYEASRKDEEKSAASKK-----------DRPSSSAKAKETQGRASSS------------- 104
            :: ::|:.:.:|.......|||           |.|.:.  .||.:|:..|:             
Zfish   138 EISVEQHMSGKKKHFYQLNSKKHHHYQPDPKMYDTPLTG--PKEVKGQDPSNKGWNLPPALQQKW 200

  Fly   105 -----TSTASKRKS---EEPTAP-SGNKSKRT--TDAEQDTIPVSGSTGFDRGLEAE-KILGASD 157
                 |...||.|.   |....| :.||::||  |.|::..:|        .|:.:: ||:...:
Zfish   201 IRNKDTGCLSKVKDLSIELKGLPDNANKAERTLKTSAKEFALP--------NGISSKMKIIKNKN 257

  Fly   158 NNGRLTFLIQFKGVDQAEMVPSSVANEKIPRM-VIHFYEERLSWYSDNED 206
            .|||:. ::..|.:|:. :..|.|.|..:.:: .:|..|..::...:..|
Zfish   258 KNGRIV-IVMSKYMDKG-VHSSKVKNRDVSQVGTVHNEEPPVNGTDNRSD 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/134 (16%)
ChSh 141..202 CDD:197638 13/62 (21%)
cbx4NP_991312.1 Chromo 13..60 CDD:278797 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.