DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cdyl

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_696879.5 Gene:cdyl / 568457 ZFINID:ZDB-GENE-070912-561 Length:581 Species:Danio rerio


Alignment Length:151 Identity:48/151 - (31%)
Similarity:77/151 - (50%) Gaps:14/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEEYAVEKIIDRRV-RKGKVEYYLKWKGYPETENTWEPENNL-DCQDLIQQYEASRKDEEKSAA- 82
            ||.|.||:||.:|. :|||.||.::|:||....:|||||.:| .|.:.|.::.....:::|... 
Zfish     5 EELYEVERIIGKRKNKKGKTEYLVRWRGYSFEGDTWEPEGHLSSCIEFIHEFNRQHSEKQKDGTL 69

  Fly    83 --SKKDRPS---SSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTG 142
              |.:..||   :|..|::...|....::.::..|:..|| |:.:.:||...| |::...|.|..
Zfish    70 LRSTRSSPSTANTSINARKQISRPQHPSANSNTAKTSTPT-PNTHPTKRPQPA-QNSSNDSDSPQ 132

  Fly   143 FDRGLEAEKILGASDNNGRLT 163
            ..||..|    |.|...|.:|
Zfish   133 QKRGRSA----GTSSIMGTVT 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/49 (45%)
ChSh 141..202 CDD:197638 7/23 (30%)
cdylXP_696879.5 CHROMO 8..61 CDD:214605 22/52 (42%)
crotonase-like 327..523 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.