DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cbx3b

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001373276.1 Gene:cbx3b / 567497 ZFINID:ZDB-GENE-070628-2 Length:194 Species:Danio rerio


Alignment Length:203 Identity:76/203 - (37%)
Similarity:115/203 - (56%) Gaps:19/203 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ESSAKVSDAEEEE--EEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQY- 70
            :.:.|...|||..  :|:||||||.|||..|||||||||||:.:.|||||||:||||.:||::| 
Zfish     4 KQNVKNRKAEETTVVQEFAVEKIIRRRVNNGKVEYYLKWKGFTDAENTWEPEDNLDCPELIEEYL 68

  Fly    71 ---EASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQ 132
               ....::.|:......|.   ..:.||   ..|...:..:.::.:|......|:.....:|| 
Zfish    69 RNLTVLGQETEQEECQSLDH---EVQPKE---ELSELAADMAHQQPQEELIERTNEEVEEHNAE- 126

  Fly   133 DTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEER 197
              ||| |..|..   |.:.|:|.:|..|.|.|||::|..|:..::.:..|:::.|:|||.|||::
Zfish   127 --IPV-GQPGHP---EPDCIIGCTDQQGELMFLIKWKNTDEVALLAAVEASKRWPQMVIRFYEDK 185

  Fly   198 LSWYSDNE 205
            |:|:.|:|
Zfish   186 LTWHGDDE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 34/51 (67%)
ChSh 141..202 CDD:197638 22/60 (37%)
cbx3bNP_001373276.1 CD_CSD 20..68 CDD:421697 34/47 (72%)
Chromo_shadow 136..188 CDD:396116 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8383
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.